Third-Party Tested ≥98% HPLC Purity — USA Shipped

Cagrilintide - Research Peptide
Metabolic & Incretin 10mg

Cagrilintide

Cagrilintide is a long-acting synthetic amylin analogue for obesity and metabolic research. Supplied as lyophilized powder at ≥98% HPLC purity, third-party tested by HPLC and mass spectrometry, with a lot-specific COA.

$85.00 In Stock
$85.00
1
≥98%
HPLC Purity
COA
Included
USA
Based Supplier

Description

Long-acting synthetic amylin analogue for obesity and metabolic research.

Cagrilintide is a long-acting acylated amylin analogue engineered for extended receptor engagement at the amylin receptor complex (AMY1 and AMY3). Its mechanism involves activating calcitonin and amylin receptors in the area postrema and hypothalamus, modulating satiety signaling and gastric emptying. Compared to pramlintide, the only previously available amylin analogue, cagrilintide offers a substantially longer half-life (approximately 7 days vs. Research also indicates potential benefits in alcohol-related liver disease models, where amylin signaling may reduce hepatic lipid accumulation. The lyophilized powder should be stored at -20C prior to reconstitution with sterile water or bacteriostatic water; reconstituted solutions should be refrigerated at 2-8C. This compound is primarily studied by obesity research institutes, pharmaceutical laboratories investigating incretin-amylin synergy, and academic centers focused on appetite neurobiology and hepatic metabolism.

This product is supplied as a lyophilized powder and is intended for laboratory and research use only. Not for human consumption. Each vial contains 10mg of research-grade material.

Read the full Cagrilintide research guide

Research Applications

  • Metabolic and glucose-regulation research
  • Incretin-pathway combination research
  • Hepatic-injury models
  • Cardiovascular condition exploration

Specifications

Size
10mg
Purity
≥98% (HPLC)
Form
Lyophilized Powder
Molecular Formula
C194H312N54O59S2
Molecular Weight
4409.01 g/mol
CAS Number
1415456-99-3
Sequence
XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Storage & Handling

  • Long-term storage: -20°C in a sealed, light-protected container
  • Short-term storage: 2-8°C (refrigerated) for up to 30 days
  • Reconstituted: Store at 2-8°C and use within 30 days
  • Avoid: Repeated freeze-thaw cycles, direct sunlight, and moisture exposure
  • Reconstitution: Use bacteriostatic water or sterile water for injection

Frequently Asked Questions

What is Cagrilintide and how does it work?
Cagrilintide is a long-acting synthetic analogue of amylin, a hormone co-secreted with insulin from pancreatic beta cells. It binds to amylin receptors (AMY1 and AMY3), which in preclinical models has been observed to influence satiety signaling, gastric emptying rate, and post-meal glucagon secretion. Its acylated fatty acid modification extends its half-life, enabling less frequent in research studies.
What research has been done on Cagrilintide?
Novo Nordisk's Phase 2 trials (published 2021-2023) studied cagrilintide both as a monotherapy and in combination with semaglutide (the CagriSema program). Research data showed statistically significant reductions in body weight compared to placebo. Preclinical studies have also investigated its effects on alcohol-related liver disease models and cardiovascular biomarkers in animal subjects.
How does Cagrilintide compare to Pramlintide?
In comparative studies, cagrilintide demonstrated stronger receptor binding affinity at AMY1 and AMY3 receptors than native amylin or pramlintide.

Related Products

Research Use Only. This product is not intended for human consumption, therapeutic use, or diagnostic purposes. All peptides sold by Elyte Peptides are strictly for in-vitro research and laboratory use. By purchasing, you agree to use this product in compliance with all applicable laws and regulations.